PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco004416.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family MYB
Protein Properties Length: 989aa    MW: 110139 Da    PI: 4.8397
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco004416.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.71.3e-1886132148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W+++Ede++++ vk++G++ W+tI++ ++ gR +kqc++rw+++l
      Aco004416.1  86 KGPWSKQEDEIIIQMVKKYGPKKWSTISQALP-GRIGKQCRERWHNHL 132
                      79******************************.*************97 PP

2Myb_DNA-binding45.51.7e-14138180145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT++E+  l++a++ +G++ W+   + ++ gRt++ +k++w+
      Aco004416.1 138 KEAWTQDEEIALIHAHQIYGNK-WAELTKFLP-GRTDNAIKNHWN 180
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500903.9156180IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.3E-126497IPR009057Homeodomain-like
PROSITE profilePS5129431.32581136IPR017930Myb domain
SuperFamilySSF466891.24E-3083179IPR009057Homeodomain-like
SMARTSM007175.7E-1885134IPR001005SANT/Myb domain
CDDcd001671.34E-1588132No hitNo description
PfamPF139217.7E-1889149No hitNo description
Gene3DG3DSA:1.10.10.606.9E-2598139IPR009057Homeodomain-like
PROSITE profilePS5129418.782137187IPR017930Myb domain
SMARTSM007178.0E-14137185IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-20140187IPR009057Homeodomain-like
CDDcd001671.07E-10140180No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 989 aa     Download sequence    Send to blast
SSIGWGSGQR YSSEMESDKE TVSERGEAST SVAAHQGSCN NAQRRRPLNG LMNIYLLYLP  60
AECFLDRTDV QCLHRWQKVL NPELVKGPWS KQEDEIIIQM VKKYGPKKWS TISQALPGRI  120
GKQCRERWHN HLNPAINKEA WTQDEEIALI HAHQIYGNKW AELTKFLPGR TDNAIKNHWN  180
SSVKKKLDSY SASGLLSQFQ GLSHIENPSH HIPTSSVTRQ NSEDSGYKFR QEIEDLSECS  240
QASSALVPRS QSSCELSNAD PICDDLEVKP IHNDFEVQDY DFSFCPQEYQ NSIEEITREL  300
PNVPHERSAL EEARDVDNEV EVSQRINTHM ALQQMLDDSL VEDTKKYLEY NGTSSNFYIE  360
NEELRGPKVP ASVTSSDHSF PSDFCQDNSL QYTISTPDMT NSGHLSGISC QHDAYSFEPH  420
RNFGSYTSPL YHVSSSSMLD SSYYQSLTTV VHPSFICPND GKSTGKSDKT ERNHIFPETN  480
NLVQITCPDD GVLKEIDALS DGKQMVVNEE QKDNGALFYE PPRFPSLDIP FVSCDLISSS  540
DDLQQDFSPL GIRQLMRSSM NFSNPFSFSD SPSHDESPDF VLKSAAKSFI CTPSIMKKRQ  600
RELLSPSNDH RADKKTGITV DCELFAISSS ISLTAQFADS CIGDAKAENF ACGSSSNCER  660
MKEEVSAERM EDLCNASGYR KDKDVSEDEK ITVEEPSSIR SETMARQDMS TSASAWKIDS  720
NSTEEEQHAG ILVEYNVNDL LMFSPESGSY PGYSKTGAKY SKHQFRPLDF TSDKCCSTSQ  780
LNFISVLSPS VGKWEGQPPL PATSIQSIQP TEVKVENFGS SIDVDFENLN ILADTPSIKR  840
GIESPSAWKS PWFMNSVLLA PRIETDMTYQ DIGYLMSPGG DGTYDAIGLM RQLSEHTAAA  900
VAEAHEVLAS GSPRIGLEER KSDKKIFPKE KDQSMKAFDM PPKVTAEARV LDFSGCAMPA  960
RTETKKIGIA GTSVSLSSPS SYLLKSCR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C3e-595818735159MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-595818735159MYB PROTO-ONCOGENE PROTEIN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008800072.10.0PREDICTED: myb-related protein 3R-1-like isoform X1
RefseqXP_008800147.10.0PREDICTED: myb-related protein 3R-1-like isoform X1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.17e-82Homeodomain-like protein